CAV3 Rabbit Polyclonal Antibody

• Catalog Number: orb331571
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CAV3
• Target: CAV3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAV3
• Protein Sequence: Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG
• UniProt ID: P56539
• MW: 17kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti LQT9 antibody, anti VIP21 antibody, anti LGMD
• Research Area: Cell Biology, Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_001225

Lanes: Lane 1: 50 ug human placental tissue lysate, Lane 2: 40 ug human placental tissue lysate, Lane 3: 30 ug human placental tissue lysate, Lane 4: 20 ug human placental tissue lysate, Lane 5: 20 ug human myometrial tissue lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: Caveolin 3.

Sample Type: Human placental tissue, Primary Antibody dilution: 1:50, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody dilution: 1:10000, Color/Signal Descriptions: Brown: CAV3 Purple: Haemotoxylin, Gene Name: CAV3.

WB Suggested Anti-CAV3 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human muscle.