CAV3 antibody

• Catalog Number: orb331571
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CAV3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Human, Mouse, Porcine, Rat
• Reactivity: Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAV3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17kDa
• Target: CAV3
• UniProt ID: P56539
• Protein Sequence: Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG
• NCBI: NP_001225
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti LQT9 antibody, anti VIP21 antibody, anti LGMD
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human placental tissue using CAV3 antibody

Western blot analysis of human placenta tissue using CAV3 antibody

Western blot analysis of human muscle tissue using CAV3 antibody