CART (1-39), Human, Rat

SKU: orb2693444

Description

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior.

Images & Validation

−

Key Properties

−

Target	Neuropeptide Y Receptor
Molecular Weight	4369.76
Protein Sequence	{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ
Purity	≥95%

Storage & Handling

−

Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Neuropeptide Y Receptor

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols