Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CART (1-39), Human, Rat

SKU: orb2693444

Description

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior.

Research Area

Neuroscience

Images & Validation

Key Properties

TargetNeuropeptide Y Receptor
MW4369.76
Purity≥95%
FormulaC188H303N57O63
Protein Sequence{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ

Storage & Handling

Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • CARTPT Polyclonal Antibody [orb3149811]

    ELISA,  IHC,  WB

    Bovine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • CART (1-39), Human, Rat [orb1981079]

    4369.76

    5 mg, 50 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

CART (1-39), Human, Rat (orb2693444)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet