You have no items in your shopping cart.
CAP - 18, rabbit
SKU: orb2692684
Description
Images & Validation
−
Key Properties
−| Target | Bacterial |
|---|---|
| Molecular Weight | 4433.49 |
| Protein Sequence | GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Bacterial
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
CAP - 18, rabbit (orb2692684)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review