CAP - 18, rabbit

• Catalog Number: orb2692684
• Category: Proteins
• Description: CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antimicrobial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria. CAP18 (rabbit) has the potential for bacterial sepsis research.
• Target: Bacterial
• Purity: ≥95%
• Protein Sequence: GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
• MW: 4433.49
• CAS Number: 152742-15-9
• Formula: C₂₀₂H₃₅₆N₆₄O₄₇
• Note: For research use only