You have no items in your shopping cart.
Cart summary
Canine SCF protein
Catalog Number: orb1215699
| Catalog Number | orb1215699 |
|---|---|
| Category | Proteins |
| Description | The Canine SCF Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF Biotinylated applications are for cell culture. Canine SCF Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Biotinylated Specifications: (Molecular Weight: 27.7 kDa) (Amino Acid Sequence: GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)) (Gene ID: 403507). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 27.7 kDa |
| Target | SCF |
| Protein Sequence | GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) |
| Protein Length | 248 |
| Source | Yeast |
| Biological Origin | Canine |
| Storage | -20°C |
| Alternative names | Kit Ligand; Stem Cell Factor Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Canine SCF protein [orb223878]
SDS-PAGE
Unconjugated
> 96% by SDS-PAGE and HPLC analyses.
18.4 kDa
E. coli
10 μg, 100 μg, 500 μg Rat SCF protein [orb107801]
HPLC, SDS-PAGE
Unconjugated
> 95% by SDS-PAGE and HPLC analyses
18.5 kDa
10 μg, 100 μg, 500 μg
