Canine IL-6 protein

• Catalog Number: orb1216333
• Category: Proteins
• Description: The Canine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-6 Specifications: (Molecular Weight: 20.0 kDa) (Amino Acid Sequence: FPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDEWLKHTTIHLILRSLEDFLQFSLRAVRIM) (Gene ID: 403985).
• Form/Appearance: Lyophilized
• Purity: 98%
• MW: 21.0 kDa
• Target: IL-6
• Protein Sequence: FPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDEWLKHTTIHLILRSLEDFLQFSLRAVRIM
• Protein Length: 187
• Source: Yeast
• Biological Origin: Canine
• Storage: -20°C
• Note: For research use only
• Expiration Date: 6 months from date of receipt.