You have no items in your shopping cart.
Cart summary
Canine IL-5 protein
Catalog Number: orb1216325
| Catalog Number | orb1216325 |
|---|---|
| Category | Proteins |
| Description | The Canine IL-5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-5 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-5 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES) (Gene ID: 403790). |
| Target | IL-5 |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES |
| Protein Length | 113 |
| MW | 13.1 kDa |
| Source | Yeast |
| Biological Origin | Canine |
| Storage | -20°C |
| Note | For research use only |
k9IL5 Protein [orb1471920]
Greater than 90.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
2 μg, 10 μg, 1 mgIL-5 Protein, Canine, Recombinant (His) [orb1956951]
98.00%
14.54 kDa (predicted); 17-19 kDa (reducing condition, due to glycosylation)
100 μgCanine IL5 Protein, His Tag [orb2698702]
> 98%, determined by SDS-PAGE
This protein contains the extracellular domain of canine IL5 (NP_001006951.1) (Met 1-Ser 134) was expressed from Baculovirus-Insect Cells.
100 μg, 50 μg
