Canine IL-1ra protein

• Catalog Number: orb1216235
• Category: Proteins
• Description: The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)) (Gene ID: 403660).
• Target: IL-1ra
• Form/Appearance: Lyophilized
• Purity: 98%
• Protein Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)
• Protein Length: 149
• MW: 16.8 kDa
• Source: Yeast
• Biological Origin: Canine
• Storage: -20°C
• Alternative names: IL-1F3
• Note: For research use only