You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216339 |
---|---|
Category | Proteins |
Description | The Canine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 beta Specifications: (Molecular Weight: 17.5 kDa) (Amino Acid Sequence: AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS) (Gene ID: 403974). |
Target | IL-1 beta |
Form/Appearance | Lyophilized |
Purity | 98% |
Protein Sequence | AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS |
Protein Length | 152 |
MW | 17.5 kDa |
Source | Yeast |
Biological Origin | Canine |
Storage | -20°C |
Alternative names | IL-1F2 |
Note | For research use only |
HPLC, SDS-PAGE | |
Unconjugated | |
> 95 % by SDS-PAGE and HPLC analyses | |
17.6 kDa |
Greater than 95.0% as determined by SDS-PAGE. | |
Escherichia Coli |
95.40% | |
17.6 kDa (predicted); 17 kDa (reducing conditions) |
Canine |