CALB1 antibody

• Catalog Number: orb326328
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CALB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CALB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 30kDa
• Target: CALB1
• UniProt ID: P05937
• Protein Sequence: Synthetic peptide located within the following region: EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM
• NCBI: NP_004920
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CALB antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of Tadpole tegmenta tissue using CALB1 antibody

Immunohistochemical staining of Tadpole tegmenta tissue using CALB1 antibody

Immunohistochemical staining of Tadpole forebrain tissue using CALB1 antibody

Immunohistochemical staining of Tadpole tissue using CALB1 antibody

Western blot analysis of human COLO205 tissue using CALB1 antibody

Immunohistochemical staining of human purkinje fibers tissue using CALB1 antibody