CALB1 Rabbit Polyclonal Antibody

• Catalog Number: orb326328
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CALB1
• Target: CALB1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Frog, Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CALB1
• Protein Sequence: Synthetic peptide located within the following region: EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM
• UniProt ID: P05937
• MW: 30kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CALB antibody
• Research Area: Neuroscience
• Note: For research use only
• NCBI: NP_004920
• Expiration Date: 12 months from date of receipt.

Application: IHC, Species+tissue/cell type: Tadpole tegmenta horizontal section, Primary antibody Dilution: 1:500, Secondary antibody: Donkey anti-rabbit Alexa 488, Secondary antibody Dilution: 1:500.

CALB1 antibody - C-terminal region (orb326328) validated by WB using COLO205 cells lysate at 1 ug/mL.

CALB1 Antibody (orb326328) tested in Purkinje neurons in human cerebellum> Calbindin 1 was detected using HRP/DAB brown color stain.

Primary Antibody Dilution: 1:500, Secondary Antibody: Donkey anti-rabbit Alexa 488, Secondary Antibody Dilution: 1:500, Gene Name: CALB1.

Primary Antibody Dilution: 1:500, Secondary Antibody: Donkey anti-rabbit Alexa 488, Secondary Antibody Dilution: 1:500, Gene Name: CALB1.

Species+tissue/cell type: Tadpole forebrain horizontal section, Primary antibody Dilution: 1:500, Secondary antibody: Donkey anti-rabbit Alexa 488, Secondary antibody Dilution: 1:500.