You have no items in your shopping cart.
Featured
Description
Research Area
Neuroscience, Pharmacology & Drug Discovery
Images & Validation
−
Key Properties
−| Target | CGRP Receptor |
|---|---|
| MW | 4469.06 |
| Purity | 99.88% (May vary between batches) |
| Formula | C196H316N54O61S2 |
| Protein Sequence | {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
CGRP Receptor
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days