Cagrilintide acetate

SKU: orb1981187

Featured

Description

Cagrilintide acetate is the salt form of a long-acting amylin analog. It is used in research for type 2 diabetes and obesity, functioning as an agonist at the AMY3 and CTR receptors to suppress appetite. Its applications include in vitro receptor studies and in vivo models investigating metabolic regulation and weight loss.

Research Area

Neuroscience, Pharmacology & Drug Discovery

Images & Validation

−

Key Properties

−

Target	CGRP Receptor
Protein Sequence	{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
Molecular Weight	4469.06
Purity	99.88%
Formula	C₁₉₆H₃₁₆N₅₄O₆₁S₂

Storage & Handling

−

Storage	keep away from moisture,keep away from direct sunlight,store at low temperature \| Powder: -20°C for 3 years \| In solvent: -80°C for 1 year \| Shipping with blue ice/Shipping at ambient temperature.
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

CGRP Receptor

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols