You have no items in your shopping cart.
Cart summary
CADM3 Peptide - C-terminal region
Catalog Number: orb1999796
| Catalog Number | orb1999796 |
|---|---|
| Category | Proteins |
| Description | CADM3 Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: LIFLGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGQSGGDDKKEYF |
| UniProt ID | Q8N126 |
| MW | 38 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | BIgR, NECL1, TSLL1, IGSF4B, Necl-1, synCAM3 |
| Note | For research use only |
| NCBI | NP_001120645.1 |
