CACNG1/CACNG Antibody

• Catalog Number: orb1536761
• Category: Antibodies
• Description: CACNG1/CACNG Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IHC-P, WB
• Reactivity: Mouse, Rat
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human CACNG1 (NP_000718.1). DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI
• Concentration: 1.58 mg/ml
• Dilution range: IHC, IHC-P (1:200), WB (1:1000 - 1:4000)
• Conjugation: Unconjugated
• Target: CACNG1 / CACNG
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Alternative names: CACNG1, CACNG, CACNLG, Gamma 1
• Note: For research use only
• Application notes: Further information: The predicted MW is 25kDa, while the observed MW by Western blot was 23kDa.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of extracts of various cell lines, using CACNG1 antibody at 1:1000 dilution.