You have no items in your shopping cart.
Description
Images & Validation
−Item 1 of 1
| Tested Applications | IHC, IHC-P, WB |
|---|---|
| Dilution Range | IHC, IHC-P (1:200), WB (1:1000 - 1:4000) |
| Reactivity | Mouse, Rat |
| Application Notes |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human CACNG1 (NP_000718.1). DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI |
| Target | CACNG1 / CACNG |
| Purification | Affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. |
| Concentration | 1.58 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CACNG1, CACNG, CACNLG, Gamma 1
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western blot analysis of extracts of various cell lines, using CACNG1 antibody at 1:1000 dilution.
Quick Database Links
Gene Symbol
CACNG1 / CACNG
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC
Immunohistochemistry
IHC-P
Immunohistochemistry Paraffin
CACNG1/CACNG Antibody (orb1536761)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review