You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329837 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CACNA1G |
Target | CACNA1G |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CACNA1G |
Protein Sequence | Synthetic peptide located within the following region: VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS |
UniProt ID | O43497 |
MW | 241 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti Ca(V)T.1 antibody, anti Cav3.1 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_938202 |
25 ug of the indicated whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.
Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5 ug/mL using anti-CACNA1G antibody (orb329837).
WB Suggested Anti-CACNA1G Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Spleen.
IF, IHC-Fr, IHC-P | |
Bovine, Canine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy3 |