CACNA1G Rabbit Polyclonal Antibody

• Catalog Number: orb329837
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CACNA1G
• Target: CACNA1G
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CACNA1G
• Protein Sequence: Synthetic peptide located within the following region: VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS
• UniProt ID: O43497
• MW: 241 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti Ca(V)T.1 antibody, anti Cav3.1 antibody, anti
• Note: For research use only
• NCBI: NP_938202

25 ug of the indicated whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5 ug/mL using anti-CACNA1G antibody (orb329837).

WB Suggested Anti-CACNA1G Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Spleen.