Cart summary

You have no items in your shopping cart.

CA14 Peptide - N-terminal region

CA14 Peptide - N-terminal region

Catalog Number: orb2001414

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2001414
CategoryProteins
DescriptionCA14 Peptide - N-terminal region
Tested applicationsWB
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW38 kDa
UniProt IDQ9ULX7
Protein SequenceSynthetic peptide located within the following region: AADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPAL
NCBINP_036245.1
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesCAXiV
Read more...
NoteFor research use only
Expiration Date6 months from date of receipt.