Cart summary

You have no items in your shopping cart.

C9orf43 Rabbit Polyclonal Antibody (FITC)

C9orf43 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2104845

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2104845
CategoryAntibodies
DescriptionC9orf43 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Human, Porcine, Yeast
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C9orf43
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW52kDa
UniProt IDQ8TAL5
Protein SequenceSynthetic peptide located within the following region: PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE
NCBINP_689999
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesMGC17358
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.