Cart summary

You have no items in your shopping cart.

C9orf116 Rabbit Polyclonal Antibody (Biotin)

C9orf116 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2087338

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087338
CategoryAntibodies
DescriptionC9orf116 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human C9orf116
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW14kDa
UniProt IDQ5BN46
Protein SequenceSynthetic peptide located within the following region: NNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQL
NCBINP_001041730
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesPIERCE1, RbEST47
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.