Cart summary

You have no items in your shopping cart.

C4orf45 Rabbit Polyclonal Antibody (Biotin)

C4orf45 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2087242

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087242
CategoryAntibodies
DescriptionC4orf45 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityEquine, Human
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human C4orf45
Protein SequenceSynthetic peptide located within the following region: PWQPKPHVLDMQGKQSRASFAWHMSAFEDTDQRNSKWAILVRQCKSSLPR
UniProt IDQ96LM5
MW21kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
NoteFor research use only
NCBINP_689756