Cart summary

You have no items in your shopping cart.

C3orf59 Rabbit Polyclonal Antibody (FITC)

C3orf59 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2107854

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2107854
CategoryAntibodies
DescriptionC3orf59 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human C3orf59
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW55kDa
UniProt IDQ8IYB1
Protein SequenceSynthetic peptide located within the following region: QSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKF
NCBINP_848591
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesC3orf59
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.