You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb587310 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to C1orf141 |
| Target | C1orf141 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Canine, Guinea pig, Porcine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human C1orf141 |
| Protein Sequence | Synthetic peptide located within the following region: KAISKIKEDKSCSITKSKMHVSFKCEPEPRKSNFEKSNLRPFFIQTNVKN |
| UniProt ID | Q5JVX7 |
| MW | 44kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_001263280 |

Sample Type: HepG2 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.
IF, IHC-Fr, IHC-P | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Human | |
Rabbit | |
Polyclonal | |
APC/Cy5.5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review