Cart summary

You have no items in your shopping cart.

C1orf105 Rabbit Polyclonal Antibody (FITC)

C1orf105 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2087481

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087481
CategoryAntibodies
DescriptionC1orf105 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human C1orf105
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW20kDa
UniProt IDO95561
Protein SequenceSynthetic peptide located within the following region: PEPFHDDIPTESIHYRLPILGPRTAVFHGLLTEAYKTLKERQRSSLPRKE
NCBINP_640333
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.