Cart summary

You have no items in your shopping cart.

C19orf67 Rabbit Polyclonal Antibody (FITC)

C19orf67 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2086779

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2086779
CategoryAntibodies
DescriptionC19orf67 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human C19orf67
Protein SequenceSynthetic peptide located within the following region: GPAPPRLSLDTLFSPITQQLRYLLKKADDFQSYLLYSRDQVQKEQLAKAM
UniProt IDA6NJJ6
MW39kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
NoteFor research use only
NCBIXP_003403752
Expiration Date12 months from date of receipt.