You have no items in your shopping cart.
Cart summary
Bsx Peptide - middle region
Catalog Number: orb2003491
| Catalog Number | orb2003491 |
|---|---|
| Category | Proteins |
| Description | Bsx Peptide - middle region |
| Predicted Reactivity | Human, Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: RRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVL |
| UniProt ID | Q810B3 |
| MW | 25kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with Bsx Rabbit Polyclonal Antibody (orb580219). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | Bsx1a, Bsx1b |
| Note | For research use only |
| NCBI | NP_839976 |
