Cart summary

You have no items in your shopping cart.

BRI3BP Rabbit Polyclonal Antibody (Biotin)

BRI3BP Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2111917

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2111917
CategoryAntibodies
DescriptionBRI3BP Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human BRI3BP
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW28kDa
UniProt IDQ8WY22
Protein SequenceSynthetic peptide located within the following region: GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK
NCBINP_542193
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesKG19, BNAS1, HCCR-1, HCCR-2, HCCRBP-1, HCCRBP-3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.