You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578488 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PLUNC |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Goat, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PLUNC |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28kDa |
Target | BPIFA1 |
UniProt ID | Q9NP55 |
Protein Sequence | Synthetic peptide located within the following region: GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL |
NCBI | NP_057667 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | LUNX, NASG, PLUNC, SPURT, SPLUNC1, bA49G10.5 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry with Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-PLUNC antibody (orb578488).
WB Suggested Anti-PLUNC Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
IHC, WB | |
Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
IHC, WB | |
Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |