You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb382970 |
---|---|
Category | Proteins |
Description | Recombinant bovine SEPP1 protein. |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 70.1 kDa |
UniProt ID | P49907 |
Protein Sequence | ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASSYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLSRKRCINQLLSQFPKDSESALSSCCCHCRHLVFEKTGSAITSQCTEKLPSLCSSQGLLAEENVIESSQSRLPPAASQAAGQQLNPTEASTKSSSKNKAKMSKSPSN |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 20-402aa(U59S,U297S,U307S,U338S,U350S,U363S,U365S,U372S,U388S,U390S,U397S,U399S). Protein Length: Full Length of Mature Protein |
Expression Region | 20-402aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Selenoprotein P-like protein Read more... |
Note | For research use only |
Application notes | E.coli and Yeast N-terminal GST-tagged Full Length |
Expiration Date | 6 months from date of receipt. |
Bovine | |
10 ng/mL-160 ng/mL | |
5 ng/mL |
Greater than 90% as determined by SDS-PAGE. | |
70.1 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
70.1 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
70.1 kDa | |
E.coli |
Filter by Rating