You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215724 |
---|---|
Category | Proteins |
Description | The Bovine IL-36 Receptor Antagonist Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-36 Receptor Antagonist Biotinylated applications are for cell culture. Bovine IL-36 Receptor Antagonist Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-36 Receptor Antagonist Biotinylated Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD) (Gene ID: 518514). |
Target | IL-1F5 |
Form/Appearance | Lyophilized |
Purity | 98% |
Protein Sequence | MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD |
Protein Length | 155 |
MW | 17.1 kDa |
Source | Yeast |
Biological Origin | Bovine |
Storage | -20°C |
Note | For research use only |