You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216385 |
---|---|
Category | Proteins |
Description | The Bovine IFN alpha A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IFN alpha A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IFN alpha A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IFN alpha A Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CHLPHTHSLA NRRVLMLLQQ LRRVSPSSCL QDRNDFEFLQ EALGGSQLQK AQAISVLHEV TQHTFQLFST EGSPATWDKS LLDKLRAALD QQLTDLQACL TQEEGLRGAP LLKEDSSLAV RKYFHRLTLY LQEKRHSPCA WEVVRAEVMR AFSSSTNLQE SFRRKD (166)) (Gene ID: 515951). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 19.0 kDa |
Target | IFN alpha |
Entrez | 515951 |
Protein Sequence | CHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFEFLQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSPATWDKSLLDKLRAALDQQLTDLQACLTQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQESFRRKD |
Protein Length | 166 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
35.7 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
35.7 kDa | |
E.coli |
Filter by Rating