You have no items in your shopping cart.
Bovine IFN alpha protein
SKU: orb1216385
Description
Research Area
Infectious Disease & Virology
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Bovine |
| Target | IFN alpha |
| Molecular Weight | 19.0 kDa |
| Protein Length | 166.0 |
| Protein Sequence | CHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFEFLQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSPATWDKSLLDKLRAALDQQLTDLQACLTQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQESFRRKD |
| Purity | 98% |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Bovine IFNW1 protein [orb8187]
Greater than 90% as determined by SDS-PAGE.
35.7 kDa
E.coli
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
IFN alpha
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Bovine IFN alpha protein (orb1216385)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

