You have no items in your shopping cart.
Cart summary
Bovine CXCL10 protein
Catalog Number: orb1216341
| Catalog Number | orb1216341 |
|---|---|
| Category | Proteins |
| Description | The Bovine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL10 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA) (Gene ID: 615107). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 9.3 kDa |
| Target | CXCL10 |
| Protein Sequence | VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA |
| Protein Length | 83 |
| Source | Yeast |
| Biological Origin | Bovine |
| Storage | -20°C |
| Alternative names | IP-10 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
