You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216341 |
---|---|
Category | Proteins |
Description | The Bovine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL10 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA) (Gene ID: 615107). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 9.3 kDa |
Target | CXCL10 |
Entrez | 615107 |
Protein Sequence | VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA |
Protein Length | 83 |
Source | Yeast |
Storage | -20°C |
Alternative names | IP-10 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Bovine | |
0.156-10ng/mL | |
0.058ng/mL |
Filter by Rating