You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216261 |
---|---|
Category | Proteins |
Description | The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)) (Gene ID: 414347). |
Target | CCL4 |
Form/Appearance | Lyophilized |
Purity | 98% |
Protein Sequence | APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69) |
Protein Length | 69 |
MW | 7.8 kDa |
Source | Yeast |
Biological Origin | Bovine |
Storage | -20°C |
Alternative names | MIP-1 beta |
Note | For research use only |