You have no items in your shopping cart.
Cart summary
Bovine CCL4 protein
Catalog Number: orb1216261
| Catalog Number | orb1216261 |
|---|---|
| Category | Proteins |
| Description | The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)) (Gene ID: 414347). |
| Target | CCL4 |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69) |
| Protein Length | 69 |
| MW | 7.8 kDa |
| Source | Yeast |
| Biological Origin | Bovine |
| Storage | -20°C |
| Alternative names | MIP-1 beta |
| Note | For research use only |
