You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb246165 |
---|---|
Category | Proteins |
Description | Recombinant Bovine Adiponectin |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 26.4 kDa |
UniProt ID | Q3Y5Z3 |
Protein Sequence | EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE |
Protein Length | Full Length of Mature Protein |
Source | Yeast |
Biological Origin | Bos taurus (Bovine) |
Expression Region | 18-240aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | ADIPOQ Read more... |
Note | For research use only |
Application notes | This is His-tag protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Bos taurus (Bovine) ADIPOQ.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Bos taurus (Bovine) ADIPOQ.
Greater than 90% as determined by SDS-PAGE. | |
40.4 kDa | |
E.coli |
Bovine | |
3.125 μg/mL-50 μg/mL | |
3.125 μg/mL |