You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Target | Angiotensin Receptor |
|---|---|
| CAS Number | 133448-20-1 |
| MW | 3453.01 |
| Purity | ≥95% |
| Formula | C146H239N47O44S3 |
| Protein Sequence | NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26) |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−
BNP Rabbit Polyclonal Antibody (PerCP-Cy5.5) [orb2560190]
IF
Human
Mouse, Rat
Rabbit
Polyclonal
PerCP/Cy5.5
100 μl
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Angiotensin Receptor
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
BNP-32, rat (orb2694983)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review