Cart summary

You have no items in your shopping cart.

BMPER Rabbit Polyclonal Antibody

SKU: orb581757

Description

Rabbit polyclonal antibody to BMPER

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human BMPER
TargetBMPER
Protein SequenceSynthetic peptide located within the following region: NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV
Molecular Weight76 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CV2, CV-2, CRIM3

Similar Products

  • BMPER Rabbit Polyclonal Antibody [orb100058]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • BMPER Antibody (N-term) [orb31244]

    WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
  • BMPER Rabbit Polyclonal Antibody (HRP) [orb2109083]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • BMPER Rabbit Polyclonal Antibody (FITC) [orb2109084]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
  • BMPER Rabbit Polyclonal Antibody (Biotin) [orb2109085]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

BMPER Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

BMPER Rabbit Polyclonal Antibody

BMPER was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb581757 with 1:200 dilution. Western blot was performed using orb581757 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: BMPER IP with orb581757 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

BMPER Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

BMPER Rabbit Polyclonal Antibody

Human Lung

BMPER Rabbit Polyclonal Antibody

Human Lung

BMPER Rabbit Polyclonal Antibody

Immunohistochemistry with Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-BMPER antibody (orb581757).

BMPER Rabbit Polyclonal Antibody

WB Suggested Anti-BMPER Antibody Titration: 1 ug/ml, Positive Control: Fetal heart lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_597725

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

BMPER Rabbit Polyclonal Antibody (orb581757)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry