You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb581757 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to BMPER |
| Target | BMPER |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human BMPER |
| Protein Sequence | Synthetic peptide located within the following region: NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV |
| UniProt ID | Q8N8U9 |
| MW | 76 kDa |
| Tested applications | IHC-P, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CV2, CV-2, CRIM3 |
| Research Area | Cell Biology, Immunology & Inflammation, Signal Tr Read more... |
| Note | For research use only |
| NCBI | NP_597725 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

BMPER was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb581757 with 1:200 dilution. Western blot was performed using orb581757 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: BMPER IP with orb581757 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Human Lung

Human Lung

Immunohistochemistry with Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-BMPER antibody (orb581757).

WB Suggested Anti-BMPER Antibody Titration: 1 ug/ml, Positive Control: Fetal heart lysate.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IF | |
Bovine, Canine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
APC |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review