Cart summary

You have no items in your shopping cart.

BMP5 Peptide - middle region

BMP5 Peptide - middle region

Catalog Number: orb2001624

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2001624
CategoryProteins
DescriptionBMP5 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: QGPQSKQPFMVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSV
UniProt IDP22003
MW52 kDa
Tested applicationsWB
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
NoteFor research use only
NCBINP_066551.1