You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
BMP4 Rabbit Polyclonal Antibody
Catalog Number: orb585513
| Catalog Number | orb585513 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to BMP4 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep |
| Reactivity | Human |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 40 kDa |
| Target | BMP4 |
| UniProt ID | P12644 |
| Protein Sequence | Synthetic peptide located within the following region: NWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSL |
| NCBI | NP_001193 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | ZYME, BMP2B, OFC11, BMP2B1, MCOPS6 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-BMP4 Antibody, Titration: 1.0 ug/ml, Positive Control: A549 Whole Cell.
- Item 1 of 2
BMP4 Rabbit Polyclonal Antibody [orb10195]
IF, IHC-Fr, IHC-P, WB
Human, Rat
Mouse, Sheep
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
Anti-BMP4 Antibody [orb412010]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 1
