You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585513 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to BMP4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40 kDa |
Target | BMP4 |
UniProt ID | P12644 |
Protein Sequence | Synthetic peptide located within the following region: NWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSL |
NCBI | NP_001193 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ZYME, BMP2B, OFC11, BMP2B1, MCOPS6 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-BMP4 Antibody, Titration: 1.0 ug/ml, Positive Control: A549 Whole Cell.
IF, IHC-Fr, IHC-P, WB | |
Human, Rat | |
Mouse, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |