BMP4 Rabbit Polyclonal Antibody

• Catalog Number: orb585513
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BMP4
• Target: BMP4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: NWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSL
• UniProt ID: P12644
• MW: 40 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ZYME, BMP2B, OFC11, BMP2B1, MCOPS6
• Note: For research use only
• NCBI: NP_001193

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-BMP4 Antibody, Titration: 1.0 ug/ml, Positive Control: A549 Whole Cell.