You have no items in your shopping cart.
Big Endothelin-1 (1-38), human
SKU: orb2694119
Description
Images & Validation
−
Key Properties
−| Target | Vasopressin Receptor |
|---|---|
| Molecular Weight | 4282.96 |
| Protein Sequence | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: Cys1-Cys15; Cys3-Cys11) |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Similar Products
−- Item 1 of 1
Big Endothelin-1 (1-38), human [orb321359]
≥95%
124363-98-0
4282.96
C189H282N48O56S5
2.5 mg, 0.5 mg, 1 mg 
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Vasopressin Receptor
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Big Endothelin-1 (1-38), human (orb2694119)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review