You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419093 |
---|---|
Category | Proteins |
Description | Recombinant Rickettsia conorii Outer membrane A |
Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 51.8 kDa |
UniProt ID | Q52657 |
Protein Sequence | DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 1734-2021aa. Protein Length: Partial |
Expression Region | 1734-2021aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | 190KDA antigen Cell surface antigen rOmp A Read more... |
Note | For research use only |
Application notes | Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1734-2021aaSequence Info: Full Length |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
54.1 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
56.3 kDa | |
E.coli |
Greater than 98.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Filter by Rating