You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604587 |
---|---|
Category | Proteins |
Description | Recombinant Enterobacteria phage T4 Double-stranded DNA-binding protein(dsbA) |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK |
Protein Length | Full Length |
UniProt ID | P13320 |
MW | 17.8 kDa |
Application notes | Full Length |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Enterobacteria phage T4 (Bacteriophage T4) |
Expression Region | 1-89aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | DsDNA-binding protein A (rpbB) |
Note | For research use only |
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) dsbA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) dsbA.