You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb595087 |
---|---|
Category | Proteins |
Description | Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 17.1 kDa |
UniProt ID | Q48RM7 |
Protein Sequence | MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK |
Protein Length | Full Length |
Source | Baculovirus |
Biological Origin | Streptococcus pyogenes serotype M28 (strain MGAS6180) |
Expression Region | 1-118aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | 4'-phosphopantetheinyl transferase AcpS (Holo-ACP Read more... |
Note | For research use only |
Application notes | Full Length |
Expiration Date | 6 months from date of receipt. |
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Greater than 85% as determined by SDS-PAGE. | |
18.3 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
16.7 kDa | |
Yeast |
Greater than 85% as determined by SDS-PAGE. | |
20.9 kDa | |
E.coli |