You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2001495 |
---|---|
Category | Proteins |
Description | B4GALT5 Peptide - middle region |
Tested applications | WB |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
MW | 45 kDa |
UniProt ID | O43286 |
Protein Sequence | Synthetic peptide located within the following region: LRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERL |
NCBI | NP_004767.1 |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Buffer/Preservatives | Lyophilized powder |
Alternative names | gt-V, B4Gal-T5, beta4Gal-T5, beta4GalT-V, BETA4-GA Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |