You have no items in your shopping cart.
Cart summary
ATP6AP1 Peptide - middle region
Catalog Number: orb2011647
| Catalog Number | orb2011647 |
|---|---|
| Category | Proteins |
| Description | ATP6AP1 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS |
| UniProt ID | Q15904 |
| MW | 52kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with ATP6AP1 Rabbit Polyclonal Antibody (orb579382). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | 16A, ATP6IP1, ATP6S1, Ac45, CF2, MGC129781, VATPS1 Read more... |
| Note | For research use only |
| NCBI | NP_001174 |
