Cart summary

You have no items in your shopping cart.

ATP1A2 Peptide - N-terminal region

ATP1A2 Peptide - N-terminal region

Catalog Number: orb1998082

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998082
CategoryProteins
DescriptionATP1A2 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: TTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGV
UniProt IDP50993
MW112 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesFHM2, MHP2
NoteFor research use only
NCBINP_000693.1
Expiration Date6 months from date of receipt.