Cart summary

You have no items in your shopping cart.

ARID4A Rabbit Polyclonal Antibody (Biotin)

ARID4A Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2137850

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2137850
CategoryAntibodies
DescriptionARID4A Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ARID4A
Protein SequenceSynthetic peptide located within the following region: NSSKCTPVKHLNVSKPQKLARSPARISPHIKDGEKDKHREKHPNSSPRTY
UniProt IDP29374
MW143kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesRBP1, RBBP1, RBP-1, RBBP-1
NoteFor research use only
NCBINP_002883