You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb588903 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Aquaporin 1 |
Target | AQP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human AQP1 |
Protein Sequence | Synthetic peptide located within the following region: PFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVE |
UniProt ID | B4F4P6 |
MW | 29 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CO, CHIP28, AQP-CHIP |
Note | For research use only |
NCBI | NP_001171989.1 |
Sample Tissue: Human ACHN Whole Cell lysates, Antibody Dilution: 1 ug/ml.
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |