Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Apolipoprotein E3 (ApoE3) 1-132 Human, Recombinant

SKU: orb2719834

Description

Apolipoprotein E3 (ApoE3) 1-132 (1.0 mg) Human, Recombinant

Research Area

Metabolism Research

Images & Validation

Key Properties

SourceProtein expressed in Escherichia coli.
MW15491.34 Da
Purity>95% by Chromatography and SDS-PAGE
Protein SequenceMKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQE ELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQA RLGADMEDVCGRLVQYRGEVQAMLGQSTEE

Storage & Handling

StorageRoom temperature, avoid light exposure.
Form/AppearanceLyophilized 1 mg/vial
Expiration Date12 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 500.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry