You have no items in your shopping cart.
Apolipoprotein E3 (ApoE3) 1-132 Human, Recombinant
SKU: orb2719834
Description
Images & Validation
−
Key Properties
−| Source | Protein expressed in Escherichia coli. |
|---|---|
| Molecular Weight | 15491.34 Da |
| Protein Sequence | MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQE ELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQA RLGADMEDVCGRLVQYRGEVQAMLGQSTEE |
| Purity | >95% by Chromatography and SDS-PAGE |
Storage & Handling
−| Storage | Room temperature, avoid light exposure. |
|---|---|
| Form/Appearance | Lyophilized 1 mg/vial |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Apolipoprotein E3 (ApoE3) 1-132 Human, Recombinant (orb2719834)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days