Cart summary

You have no items in your shopping cart.

Apolipoprotein E2 (ApoE2) 1-132 Human, Recombinant

SKU: orb2719830

Description

Apolipoprotein E2 (ApoE2) 1-132 (1.0 mg) Human, Recombinant

Images & Validation

Key Properties

SourceProtein expressed in Escherichia coli.
Molecular Weight15491.34 Da
Protein SequenceMKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQE ELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQA RLGADMEDVCGRLVQYRGEVQAMLGQSTEE
Purity>95% by Chromatography and SDS-PAGE

Storage & Handling

StorageRoom temperature, avoid light exposure.
Form/AppearanceLyophilized 1 mg/vial
Expiration Date12 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Apolipoprotein E2 (ApoE2) 1-132 Human, Recombinant (orb2719830)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

1 mg
$ 500.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry