Cart summary

You have no items in your shopping cart.

APOBEC3C Peptide - C-terminal region

APOBEC3C Peptide - C-terminal region

Catalog Number: orb2001233

Select Product Size
SizePriceQuantity
100 μg$ 230.00
100 μg Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2001233
CategoryProteins
DescriptionAPOBEC3C Peptide - C-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: EGLRSLSQEGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLK
UniProt IDQ9NRW3
MW23 kDa
Tested applicationsWB
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesA3C, PBI, ARP5, ARDC2, ARDC4, APOBEC1L, bK150C2.3
NoteFor research use only
NCBINP_055323.2
Images
Similar Products
Reviews

APOBEC3C Peptide - C-terminal region (orb2001233)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet