You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2602826 |
---|---|
Category | Antibodies |
Description | Anti-SARS-CoV-2 ORF8 Antibody. Tested in ELISA applications. This antibody reacts with Human. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ELISA |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
Antibody Type | Primary Antibody |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | HRP |
MW | 140 kDa, 130 kDa, 110 kDa |
UniProt ID | P0DTC8 |
Storage | Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | ORF8 protein; ORF8; Non-structural protein 8; ns8 Read more... |
Note | For research use only |
Application notes | ELISA, 0.001-0.1μg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml |
Expiration Date | 12 months from date of receipt. |