Cart summary

You have no items in your shopping cart.

Amyloid Dan Protein (1-34) (reduced)

SKU: orb2693177

Description

Amyloid Dan Protein (1-34) (reduced)

Images & Validation

Key Properties

TargetAmyloid-β
Molecular Weight4046.63
Protein Sequence{Pyr}-ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY
Purity≥95%

Storage & Handling

DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Amyloid Dan Protein (1-34) (reduced) (orb2693177)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 mg
$ 530.00
10 mg
$ 860.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry