You have no items in your shopping cart.
Amyloid Dan Protein (1-34) (reduced)
SKU: orb2693177
Description
Images & Validation
−
Key Properties
−| Target | Amyloid-β |
|---|---|
| Molecular Weight | 4046.63 |
| Protein Sequence | {Pyr}-ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Amyloid-β
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Amyloid Dan Protein (1-34) (reduced) (orb2693177)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review