Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Amyloid Dan Protein (1-34) (reduced)

SKU: orb2693177

Description

Amyloid Dan Protein (1-34) (reduced)

Research Area

Neuroscience

Images & Validation

Key Properties

TargetAmyloid-β
CAS Number1802083-00-6
MW4046.63
Purity≥95%
FormulaC185H270N48O51S2
Protein Sequence{Pyr}-ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY

Storage & Handling

Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Amyloid Dan Protein (1-34) (reduced) (orb2693177)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 mg
$ 530.00
10 mg
$ 860.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry