β-Amyloid (1-40), rat

SKU: orb2693355

Description

β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD). β-Amyloid (1-40) (rat) increases 45Ca2+ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer's disease.

Images & Validation

−

Key Properties

−

Target	Amyloid-β; Apoptosis
Molecular Weight	4233.81
Protein Sequence	DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Purity	≥95%

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Amyloid-β; Apoptosis

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols