You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2693379 |
---|---|
Category | Proteins |
Description | Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist. |
Target | Amylin Receptor |
Purity | ≥95% |
Protein Sequence | ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
MW | 3200.63 |
Solubility (25°C) | Water: 50 mg/mL |
CAS Number | 138398-61-5 |
Formula | C140H227N43O43 |
Note | For research use only |