You have no items in your shopping cart.
Amylin (8-37),rat
SKU: orb2693379
Description
Images & Validation
−
Key Properties
−| Target | Amylin Receptor |
|---|---|
| Molecular Weight | 3200.63 |
| Protein Sequence | ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Amylin Receptor
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Amylin (8-37),rat (orb2693379)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days